} }; "action" : "rerender" { } ] ] "event" : "addMessageUserEmailSubscription", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_3","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_3","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_Mobilfunk/thread-id/234563","ajaxErrorEventName":"LITHIUM:ajaxError","token":"DWLKD7WcE5s7K2ITYtTrdpOt-I_dt62imPWvB0pPvJs. "actions" : [ LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche läuft...","emptyText":"Keine Treffer","successText":"Ergebnisse:","defaultText":"Suchbegriff eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$('',{method:'POST',action:$link.attr('href'),enctype:'multipart/form-data'});var $ticket=$('',{type:'hidden',name:'lia-action-token',value:token});$form.append($ticket);$(document.body).append($form);$form.submit();$doc.trigger('click');}}}\nif($doc.data('lia-link-action-handler')===undefined){$doc.data('lia-link-action-handler',true);$doc.on('click.link-action',params.linkSelector,handler);$.fn.on=$.wrap($.fn.on,function(proceed){var ret=proceed.apply(this,$.makeArray(arguments).slice(1));if(this.is(document)){$doc.off('click.link-action',params.linkSelector,handler);proceed.call(this,'click.link-action',params.linkSelector,handler);}\nreturn ret;});}}})(LITHIUM.jQuery);\r\n\nLITHIUM.Link({\n \"linkSelector\" : \"a.lia-link-ticket-post-action\"\n});LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_17c878f67c37a8', 'disableAutoComplete', '#ajaxfeedback_17c878f5cafef8_0', 'LITHIUM:ajaxError', {}, 'eP0Uy5fZtGXxQV9XX96irkQMwLKTOANlPtadFRSKNnQ. })(LITHIUM.jQuery); }, "selector" : "#messageview_2", ctaHTML += "Lösung noch nicht gefunden? "context" : "", Um im ernstfall nachweisen zu können dass tatsächlich widerspruch eingelegt wurde sollte der kunde die fehlerhafte rechnung deshalb immer schriftlich reklamieren. "action" : "rerender" LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1804158 .lia-rating-control-passive', '#form_0'); "actions" : [ "actions" : [ }, "activecastFullscreen" : false, "initiatorDataMatcher" : "data-lia-kudos-id" "showCountOnly" : "false", LITHIUM.Tooltip({"bodySelector":"body#lia-body","delay":30,"enableOnClickForTrigger":false,"predelay":10,"triggerSelector":"#link_31b7ad0dda7b1f","tooltipContentSelector":"#link_31b7ad0dda7b1f_0-tooltip-element .content","position":["bottom","left"],"tooltipElementSelector":"#link_31b7ad0dda7b1f_0-tooltip-element","events":{"def":"focus mouseover,blur mouseout"},"hideOnLeave":true}); { '; "eventActions" : [ ] /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "}); ] "event" : "ProductAnswerComment", "context" : "", ] { }); "initiatorBinding" : true, "actions" : [ "event" : "removeThreadUserEmailSubscription", "actions" : [ { "actions" : [ "action" : "rerender" ] }, } } "displayStyle" : "horizontal", $('#vodafone-community-header .lia-search-input-wrapper').fadeToggle() //$('#vodafone-community-header .lia-search-input-wrapper').css('display','table-cell')} "action" : "pulsate" "action" : "rerender" "event" : "MessagesWidgetCommentForm", "context" : "", LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating'); LITHIUM.StarRating('#any_3', false, 1, 'LITHIUM:starRating'); "showCountOnly" : "false", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_12","feedbackSelector":".InfoMessage"}); "event" : "expandMessage", "actions" : [ "event" : "ProductMessageEdit", { } "action" : "rerender" { "event" : "MessagesWidgetEditAction", "context" : "envParam:feedbackData", "quiltName" : "ForumMessage", { { { } "truncateBody" : "true", $('.community-menu').removeClass('active') // We made it! { $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { "context" : "", { LITHIUM.Dialog.options['1766536671'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "initiatorDataMatcher" : "data-lia-message-uid" "action" : "pulsate" ] ] { ] "event" : "MessagesWidgetMessageEdit", "event" : "ProductMessageEdit", "action" : "rerender" "event" : "MessagesWidgetAnswerForm", } }, $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ LITHIUM.AjaxSupport.useTickets = false; "initiatorBinding" : true, } "showCountOnly" : "false", "}); { { "event" : "MessagesWidgetAnswerForm", // console.log('watching: ' + key); "truncateBody" : "true", { }, LITHIUM.AjaxSupport.fromForm('#form_4', 'GiveRating', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); { }, LITHIUM.Dialog.options['2017907831'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; } { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_10","feedbackSelector":".InfoMessage"}); }, "showCountOnly" : "false", "event" : "kudoEntity", } LITHIUM.AjaxSupport.fromForm('#form', 'GiveRating', '#ajaxfeedback', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "selector" : "#kudosButtonV2", "action" : "rerender" }, ', 'ajax'); "action" : "rerender" "kudosable" : "true", if ( count == neededkeys.length ) { { LITHIUM.Dialog.options['-769211050'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; } "action" : "rerender" "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_22","feedbackSelector":".InfoMessage"}); { { }, { Vertragsvereinbarungen uns gar nicht bekannt sind. "action" : "rerender" ], "kudosable" : "true", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_29","feedbackSelector":".InfoMessage"}); "useCountToKudo" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_14","feedbackSelector":".InfoMessage"}); ] else { }, LITHIUM.Dialog.options['2017907831'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; LITHIUM.MessageBodyDisplay('#bodyDisplay_2', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "event" : "removeThreadUserEmailSubscription", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_0","componentSelector":"#lineardisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1888998,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "action" : "rerender" { ] }); "event" : "editProductMessage", $(this).next().toggle(); }, "action" : "rerender" "actions" : [ ] LITHIUM.MessageBodyDisplay('#bodyDisplay_4', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); } ] } { "disallowZeroCount" : "false", "actions" : [ "context" : "envParam:feedbackData", }, "-Masche aber denkbar schlecht geeignet und erzeugt eher mitleidiges Lächeln als schlotternde Knie. { }, "action" : "pulsate" createStorage("false"); ] watching = false; }, } lithstudio: [], if (element.hasClass('active')) { { { if ( key == neededkeys[0] ) { "action" : "pulsate" } ] "event" : "deleteMessage", "entity" : "1889185", { "event" : "ProductAnswer", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] ] "event" : "MessagesWidgetMessageEdit", } }, } "showCountOnly" : "false", "context" : "", { "actions" : [ { "context" : "envParam:quiltName", "message" : "1804158", { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_3","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_3","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_Mobilfunk/thread-id/234563","ajaxErrorEventName":"LITHIUM:ajaxError","token":"DWLKD7WcE5s7K2ITYtTrdpOt-I_dt62imPWvB0pPvJs. "selector" : "#kudosButtonV2_1", "event" : "QuickReply", { } } if ( neededkeys[count] == key ) { return; "displayStyle" : "horizontal", }, "useSubjectIcons" : "true", // Reset the conditions so that someone can do it all again. "initiatorBinding" : true, "componentId" : "kudos.widget.button", { } LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_5","menuItemsSelector":".lia-menu-dropdown-items"}}); { "event" : "addMessageUserEmailSubscription", } }, "selector" : "#messageview_1", "action" : "rerender" }, "initiatorBinding" : true, "initiatorDataMatcher" : "data-lia-message-uid" LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_1","menuItemsSelector":".lia-menu-dropdown-items"}}); ] "event" : "MessagesWidgetEditAnswerForm", $(this).addClass('active') ] "action" : "rerender" "event" : "deleteMessage", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_2","componentSelector":"#lineardisplaymessageviewwrapper_2","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1889114,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "kudosLinksDisabled" : "false", ctaHTML += 'Stell Deine Frage'; }, ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); } Execute whatever should happen when entering the right sequence "action" : "rerender" "context" : "", }; //resetMenu(); "context" : "envParam:selectedMessage", { "componentId" : "kudos.widget.button", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); { "actions" : [ { { "parameters" : { LITHIUM.InputEditForm("form_4", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. } "actions" : [ // Reset the conditions so that someone can do it all again. ], { "event" : "removeMessageUserEmailSubscription", }, "displayStyle" : "horizontal", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/Archiv_Mobilfunk/thread-id/234563","ajaxErrorEventName":"LITHIUM:ajaxError","token":"hqnz4uhPPP_E7wOJW6vL9eZAbfwxH1EKPcZ6wifIMNE. } "truncateBody" : "true", { "context" : "", var key = e.keyCode; "actions" : [ "context" : "", element.children('ul').slideDown(); "action" : "rerender" { { }, "event" : "MessagesWidgetEditAnswerForm", "event" : "MessagesWidgetEditCommentForm", LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; LITHIUM.AjaxSupport.fromForm('#form_3', 'GiveRating', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); { $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "initiatorBinding" : true, { "context" : "envParam:quiltName,expandedQuiltName", } { { "action" : "rerender" "kudosLinksDisabled" : "false", ] }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_2","feedbackSelector":".InfoMessage"}); "actions" : [ ] ] }, }, "action" : "rerender" $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); ] "event" : "QuickReply", }, "action" : "rerender" "context" : "", "event" : "addThreadUserEmailSubscription", "event" : "kudoEntity", LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, 'DsiT168F61gd2qG7tCv9YhlTM1zpQIbrwWt5QwUknkQ. $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { { "messageViewOptions" : "1111110111111111111110111110100101001101" }, // We made it! "action" : "rerender" } ], { "forceSearchRequestParameterForBlurbBuilder" : "false", } { } else { "selector" : "#messageview_3", } else { { "actions" : [ ', 'ajax'); ] "event" : "addMessageUserEmailSubscription", { } "event" : "AcceptSolutionAction", "eventActions" : [ } LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234642}); "selector" : "#kudosButtonV2_2", ] }, } LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; "eventActions" : [ "disableLinks" : "false", }, "kudosable" : "true", "event" : "deleteMessage", "event" : "approveMessage", LITHIUM.AjaxSupport.fromLink('#kudoEntity', 'kudoEntity', '#ajaxfeedback', 'LITHIUM:ajaxError', {}, 'C7B9POEdhTVTTqau44rwwJkoxU1I0AHZp7yk7y6aqoo.