"event" : "markAsSpamWithoutRedirect", ich habe die altuellste Version 1.5 der CallYa Flex App auf iOS (letzte Aktualisierung vor über 1 Jahr!). LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; "truncateBodyRetainsHtml" : "false", { { }); "context" : "envParam:quiltName", ] "context" : "envParam:feedbackData", "selector" : "#messageview_8", }, }, "actions" : [ ] { ] { }, { }, "defaultAriaLabel" : "", "displaySubject" : "true", } { { "context" : "envParam:quiltName,message,product,contextId,contextUrl", "context" : "", { } "disallowZeroCount" : "false", "initiatorBinding" : true, } { LITHIUM.AjaxSupport.fromForm('#form_8', 'GiveRating', '#ajaxfeedback_8', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_2","menuItemsSelector":".lia-menu-dropdown-items"}}); "event" : "AcceptSolutionAction", "}); "displaySubject" : "true", "event" : "RevokeSolutionAction", { } "}); } "event" : "removeMessageUserEmailSubscription", "action" : "rerender" "context" : "", { ] "componentId" : "forums.widget.message-view", ] "actions" : [ { "eventActions" : [ "actions" : [ LITHIUM.MessageBodyDisplay('#bodyDisplay_8', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); { "actions" : [ { }, ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "actions" : [ { "action" : "rerender" "includeRepliesModerationState" : "false", "action" : "rerender" }); }, { "context" : "envParam:quiltName", "action" : "rerender" "action" : "rerender" "componentId" : "forums.widget.message-view", "context" : "envParam:feedbackData", }); { "context" : "envParam:selectedMessage", "action" : "pulsate" "actions" : [ LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_7","menuItemsSelector":".lia-menu-dropdown-items"}}); "actions" : [ element.siblings('li').removeClass('active'); LITHIUM.StarRating('#any_0_4', true, 2, 'LITHIUM:starRating'); "initiatorDataMatcher" : "data-lia-message-uid" { LITHIUM.DropDownMenu({"menuOffsetContainer":".lia-menu-offset-container","hoverLeaveEvent":"LITHIUM:hoverLeave","mouseoverElementSelector":".lia-js-mouseover-menu","menuOpenCssClass":"dropdownHover","clickElementSelector":".lia-js-click-menu","menuElementSelector":".lia-menu-navigation-wrapper","dialogSelector":".lia-panel-dialog-trigger","menuItemsSelector":".lia-menu-dropdown-items","menuClosedEvent":"LITHIUM:menuClosed","closeMenuEvent":"LITHIUM:closeMenu","menuOpenedEvent":"LITHIUM:menuOpened"}); }, "includeRepliesModerationState" : "false", ] "actions" : [ "useSimpleView" : "false", LITHIUM.StarRating('#any_0', true, 2, 'LITHIUM:starRating'); { "truncateBodyRetainsHtml" : "false", ], "quiltName" : "ForumMessage", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_1","componentSelector":"#lineardisplaymessageviewwrapper_1","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2207476,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "action" : "pulsate" { })(LITHIUM.jQuery); ] } { } ] "event" : "expandMessage", ] { "event" : "ProductMessageEdit", ] LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_6","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_6","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/CallYa/thread-id/89914","ajaxErrorEventName":"LITHIUM:ajaxError","token":"6pFiq0dfeKY7My_sHs-sTwY7N4SXYL3DlgQyTLzwMhs. "useCountToKudo" : "false", { APP herunterladen. "selector" : "#messageview_6", "context" : "", { "event" : "kudoEntity", @Grautvornix kannst du/ihr das bitte einmal überprüfen und vll. "actions" : [ "actions" : [ "displaySubject" : "true", }, ] "event" : "addThreadUserEmailSubscription", { "actions" : [ { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_8","componentSelector":"#lineardisplaymessageviewwrapper_8","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2211948,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. ] } // Oops. LITHIUM.AjaxSupport.ComponentEvents.set({ count++; return; "context" : "", }); "context" : "envParam:quiltName", LITHIUM.AjaxSupport.fromForm('#form_8', 'GiveRating', '#ajaxfeedback_8', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "displayStyle" : "horizontal", "context" : "", "action" : "rerender" } "componentId" : "kudos.widget.button", "initiatorBinding" : true, "action" : "rerender" "entity" : "2207320", { { })(LITHIUM.jQuery); "actions" : [ LITHIUM.AjaxSupport.fromLink('#kudoEntity', 'kudoEntity', '#ajaxfeedback', 'LITHIUM:ajaxError', {}, 'kuhN67OIqBtQQA9xKcPd7g3VHyqLhkOcfzuXjNnHap8. }); "context" : "", }, "event" : "MessagesWidgetEditAnswerForm", LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "disallowZeroCount" : "false", "actions" : [ }, { "context" : "envParam:feedbackData", "disallowZeroCount" : "false", if ( neededkeys[count] == key ) { ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "markAsSpamWithoutRedirect", { "initiatorBinding" : true, { } } } ] "action" : "rerender" "messageViewOptions" : "1111110111111111111110111110100101001101" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_48","feedbackSelector":".InfoMessage"}); Die Kunden sind sauer, denn ohne funk­tionie­rende App kann man seinen Verbrauch nicht kontrol­lieren oder den Tarif ändern oder nach­buchen. "actions" : [ "truncateBody" : "true", } { "context" : "envParam:selectedMessage", "context" : "", disableInput(pagerId); }); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_46","feedbackSelector":".InfoMessage"}); { LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_9","menuItemsSelector":".lia-menu-dropdown-items"}}); LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2207476 .lia-rating-control-passive', '#form_1'); "context" : "", { } { { "event" : "addMessageUserEmailSubscription", ] }, ] { "context" : "", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); ] return false; "actions" : [ Vodafone CallYa Flex: Tarif-App funktioniert auf dem iPhone nicht mehr. } { "disableLinks" : "false", "event" : "addThreadUserEmailSubscription", ] } ] } "context" : "", { ] ] { ] "context" : "envParam:selectedMessage", } "disableLinks" : "false", "action" : "rerender" "event" : "MessagesWidgetEditCommentForm", { { { } "context" : "", "initiatorDataMatcher" : "data-lia-kudos-id" "disableKudosForAnonUser" : "false", { { { }, "event" : "removeMessageUserEmailSubscription", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_47","feedbackSelector":".InfoMessage"}); ] } if ( Number(val) < 1 ) "event" : "addMessageUserEmailSubscription", "actions" : [ "action" : "pulsate" "context" : "envParam:quiltName,message", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_40","feedbackSelector":".InfoMessage"}); "event" : "MessagesWidgetEditAction", ] Vodafone Prepaid APN – die Einstellungen für die Callya Prepaid Tarife – Vodafone bietet die eigenen Prepaid Tarife unter dem Markennamen Callya an und mittlerweile findet man eine ganze Reihe von Tarifen und Flatrates im Callya-Angebot. "event" : "MessagesWidgetEditAction", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_43","feedbackSelector":".InfoMessage"}); "action" : "pulsate" { ] "action" : "rerender" }); } "event" : "removeMessageUserEmailSubscription", }, "useSubjectIcons" : "true", "revokeMode" : "true", { "messageViewOptions" : "1111110111111111111110111110100101001101" }, "action" : "rerender" setWarning(pagerId); { ;(function($) { "actions" : [ { "showCountOnly" : "false", "action" : "rerender" }); "disallowZeroCount" : "false", }, { { "disableKudosForAnonUser" : "false", "context" : "", Bist du sicher, dass du fortfahren möchtest? LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_8","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_8","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/CallYa/thread-id/89914","ajaxErrorEventName":"LITHIUM:ajaxError","token":"DoJrFkvaDqgHTkid3ex9bzUjmBk4_lZSoINqkcUmZFA. clearWarning(pagerId); $('.lia-button-wrapper-searchForm-action').removeClass('active'); } "context" : "envParam:entity", "message" : "2208002", "parameters" : { "action" : "rerender" else { "initiatorBinding" : true, "activecastFullscreen" : false, "event" : "QuickReply", }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_45","feedbackSelector":".InfoMessage"}); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_4","feedbackSelector":".InfoMessage"}); "event" : "QuickReply", "action" : "rerender" } }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] { } "event" : "addMessageUserEmailSubscription", "action" : "rerender" { "action" : "rerender" }, "selector" : "#kudosButtonV2_7", "action" : "rerender" } // Oops, not the right sequence, lets restart from the top. "event" : "addThreadUserEmailSubscription", } "messageViewOptions" : "1111110111111111111110111110100101001101" "action" : "rerender" "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { { } "action" : "addClassName" { "actions" : [ "initiatorBinding" : true, "actions" : [ "context" : "", "actions" : [ "event" : "deleteMessage", "showCountOnly" : "false", { } }); ] "action" : "rerender" } "action" : "rerender" "actions" : [ { "context" : "", "action" : "rerender" } "actions" : [ "includeRepliesModerationState" : "false", } ‎Die wichtigsten Online-Services in einer App. }, "context" : "envParam:quiltName,product,contextId,contextUrl", "event" : "kudoEntity", { // console.log('watching: ' + key); } "actions" : [ } Zumal wie gesagt bei aufgebrauchtem Datenvolumen ja nicht einfach eine drosselung stattfindet, sondern einfach überhaupt kein Internet mehr geht (auch keine WhatsApp Nachricht oder Ähnliches), man ist also unter Umständen nicht mal mehr wirklich zu erreichen. { } { ] ] }, "initiatorBinding" : true, "disallowZeroCount" : "false", "actions" : [ { "context" : "envParam:feedbackData", "initiatorBinding" : true, { }, "event" : "ProductMessageEdit", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_8","menuItemsSelector":".lia-menu-dropdown-items"}}); LITHIUM.StarRating('#any_0_7', true, 2, 'LITHIUM:starRating'); ] }, ;(function($) { event.returnValue = false; { }, "initiatorDataMatcher" : "data-lia-message-uid" { } ] { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_48","feedbackSelector":".InfoMessage"}); "ajaxEvent" : "LITHIUM:lightboxRenderComponent", LITHIUM.AjaxSupport.ComponentEvents.set({ ] { "action" : "rerender" ] ] "event" : "removeThreadUserEmailSubscription", }); ] { "context" : "envParam:quiltName,message", }, "initiatorBinding" : true, "event" : "MessagesWidgetAnswerForm", "actions" : [ "context" : "envParam:quiltName,message", } "actions" : [ } { }); { })(LITHIUM.jQuery); "context" : "envParam:quiltName,message", "showCountOnly" : "false", ] ], "disableLabelLinks" : "false", "useTruncatedSubject" : "true", "context" : "", "context" : "", { "context" : "", LITHIUM.MessageBodyDisplay('#bodyDisplay_1', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); if ( count == neededkeys.length ) { "message" : "2207320", } { }, { ] } "action" : "rerender" { { "action" : "rerender" ], } "parameters" : { "actions" : [ "event" : "deleteMessage", "context" : "envParam:entity", "revokeMode" : "true", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_0.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/CallYa/thread-id/88203","ajaxErrorEventName":"LITHIUM:ajaxError","token":"uzXr8y5ivjRJLfit4pgMDBOkLdm7CBosRmR4GAkXv_Q. ] "actions" : [ "action" : "rerender" "actions" : [ { ","loaderSelector":"#lineardisplaymessageviewwrapper_7 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "event" : "ProductAnswer", watching = true; "event" : "MessagesWidgetEditAction", { } "event" : "AcceptSolutionAction", } "context" : "", "context" : "envParam:quiltName,expandedQuiltName", "actions" : [ } LITHIUM.AjaxSupport.fromForm('#form_5', 'GiveRating', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "closeImageIconURL" : "https://forum.vodafone.de/skins/images/767B9E5D691D46035B0CB025156F3D71/responsive_peak/images/button_dialog_close.svg", { { "parameters" : { { "action" : "rerender" } { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { } $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ "actions" : [ ] Wenn es nicht unbedingt die LTE-Freischaltung sein muss, gibt es im D2-Netz bessere Angebote. "event" : "expandMessage", ] LITHIUM.Auth.CHECK_SESSION_TOKEN = 'ABs_7aFZnjRe_9D-cBr5Vtb0BETiljJDJVcxPh6vzTs. "event" : "ProductMessageEdit", "action" : "pulsate" "context" : "lia-deleted-state", { } else { { "parameters" : { "useSubjectIcons" : "true", $('#vodafone-community-header .lia-search-toggle').click(function() { }, LITHIUM.AjaxSupport.ComponentEvents.set({ } }, LITHIUM.AjaxSupport.fromLink('#kudoEntity_6', 'kudoEntity', '#ajaxfeedback_6', 'LITHIUM:ajaxError', {}, 'BCHFrGMm-T2wvOq_q2cLFkDgc4oonZTEBmQVNljsRo4. { $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); } } ] { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_48","feedbackSelector":".InfoMessage"}); { "actions" : [ { "context" : "envParam:selectedMessage", ] "event" : "unapproveMessage", seit mindestens 1 Woche funktioniert meine CallYa Flex App nicht mehr. "action" : "rerender" }, }, } "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_47","feedbackSelector":".InfoMessage"}); "action" : "pulsate" "initiatorDataMatcher" : "data-lia-message-uid" "linkDisabled" : "false" "actions" : [ "context" : "envParam:quiltName", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_6","menuItemsSelector":".lia-menu-dropdown-items"}}); { "actions" : [ { "parameters" : { }, ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] "event" : "AcceptSolutionAction", "}); return true; "actions" : [ }); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "revokeMode" : "true", "action" : "rerender" }, ] "action" : "rerender" } $('#vodafone-community-header .lia-search-toggle').click(function() { }, { }, { "event" : "addMessageUserEmailSubscription", "context" : "", "initiatorBinding" : true, "action" : "rerender" "action" : "rerender" "actions" : [ $('#vodafone-community-header .lia-button-wrapper-searchForm-action').toggleClass('active'); ] }, }, "event" : "kudoEntity", function disableInput(pagerId) { .attr('aria-hidden','false') "action" : "rerender" } "context" : "envParam:quiltName,product,contextId,contextUrl", { "selector" : "#kudosButtonV2_6", "event" : "expandMessage", ] } { "event" : "QuickReply", "event" : "unapproveMessage", "actions" : [ $(document).ready(function(){ } "actions" : [ LITHIUM.AjaxSupport.fromLink('#kudoEntity_3', 'kudoEntity', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {}, '2GzDvQiinfz3_gY8WLmvNQEmThjQX2W1dpQp27xMa_8. }, "action" : "rerender" "context" : "", } LITHIUM.Dialog({ "actions" : [ { "quiltName" : "ForumMessage", "context" : "envParam:selectedMessage", { ] "context" : "", }, { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl",