LITHIUM.InputEditForm("form_2", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. }, }, "context" : "", ], { "context" : "", // Reset the conditions so that someone can do it all again. { "action" : "rerender" ', 'ajax'); }, "messageViewOptions" : "1111110111111111111110111110100101001101" LITHIUM.AjaxSupport.fromForm('#form_4', 'GiveRating', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "action" : "addClassName" } } ;(function($) { { { ] ] LITHIUM.Auth.CHECK_SESSION_TOKEN = '_vcBOIDcuJmoa2VT3TVOO2jWUC4zVv7ryWp6nq0cNPs. ","loaderSelector":"#lineardisplaymessageviewwrapper_0 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "event" : "addMessageUserEmailSubscription", { "includeRepliesModerationState" : "false", ] "action" : "rerender" ] "actions" : [ } LITHIUM.Loader.runJsAttached(); "event" : "AcceptSolutionAction", } } else { "componentId" : "kudos.widget.button", "event" : "editProductMessage", { { ","loaderSelector":"#lineardisplaymessageviewwrapper_1 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); logmein: [76, 79, 71, 77, 69, 73, 78], "event" : "AcceptSolutionAction", } { }, element.siblings('li').children('ul').slideUp(); { } "context" : "", } { ] "actions" : [ "context" : "lia-deleted-state", "context" : "", "}); "actions" : [ "actions" : [ "parameters" : { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { // We made it! { { } } } { "linkDisabled" : "false" "event" : "AcceptSolutionAction", { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ }, "context" : "", { } LITHIUM.AjaxSupport.ComponentEvents.set({ resetMenu(); { }, { }, } "action" : "rerender" "action" : "addClassName" ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); }, }, "context" : "envParam:entity", } LITHIUM.Dialog.options['872401623'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "revokeMode" : "true", { }, "event" : "MessagesWidgetEditAction", "action" : "rerender" Der Service von Vodafone und den Callcentern ist wirklich das Allerletzte. { }, }, event.stopPropagation(); } "event" : "ProductMessageEdit", { "context" : "", { }, "action" : "rerender" ] }, "actions" : [ return; "action" : "addClassName" "event" : "AcceptSolutionAction", "action" : "rerender" } }, else { ctaHTML += 'Stell Deine Frage'; ] ] ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "QuickReply", { var keycodes = { } "action" : "rerender" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/Archiv_Mobilfunk/thread-id/225454","ajaxErrorEventName":"LITHIUM:ajaxError","token":"soEIzMknx3kYQXngXE5_wbfn6DMU0WRBRO2rZeVat0E. { { { "context" : "", if ( key == neededkeys[0] ) { "actions" : [ "disallowZeroCount" : "false", { return; ] "action" : "rerender" { window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":987,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaREtXBAdFAUcRDhANQhJJQVg+GDgaVVtAEFtIT10GA1ELW1YaVgBqSU0HPk12FlZbXURIewlbWw4EQgpebxsXJgVDAHEAB0UMEHAHFycADk1XTzBSB11dQVwCaklNVk8Sa0sECwwKXA9XGx5ABEUFWFZ9VkcMVwsBUlYPVQMAAQVXGkRSUTcRUhZ8VxYISAdKG1kBMlYDUH1VXwAUXBt0DRBCCWFcRFsGZgdeV0BOFQ9WfltQDFoDGwhABFYIRlYWHkddBXtdFkANRlNSWEEAFEobWQE2T0YPEVcFUQIECQcHT1QCDQsZBgEGABQLAwZRSQMLAwdWVV4IVlNQUkYZEV9RK1kCXHsGQA1GdEFXWgxAOXRdAAtbAkBdXxBJFA1aYAcRQzIHYkFXF09EAxAxJ3shdmcUWwEWIGt9L0JaAUZAVVUARUZueicwckRBXERbBhgPXQ9dQnsteHpgEloUG0Q="}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; }, LITHIUM.MessageBodyDisplay('#bodyDisplay', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "actions" : [ "action" : "rerender" $('#community-menu-toggle').click(function() { ;(function($) { "context" : "", }, "context" : "", "action" : "rerender" { "context" : "envParam:selectedMessage", "actions" : [ ] { "action" : "rerender" "event" : "MessagesWidgetEditAnswerForm", "useSubjectIcons" : "true", "actions" : [ "actions" : [ Schnell und zuverlässige Ergebnisse auf Crawster.com Vodafone Tarife Prepaid - Hol Dir die neuesten Black Friday Schnäppchen Vodafone falsche Rechnungen, Fehler oder gezielte *piep*ische Vodafone-Strategie ‎15.01.2020 22:20. "event" : "MessagesWidgetEditAction", "actions" : [ ] "actions" : [ } "disableLinks" : "false", }; "actions" : [ LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234034}); LITHIUM.Dialog.options['872401623'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "event" : "addThreadUserEmailSubscription", }, LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_2","menuItemsSelector":".lia-menu-dropdown-items"}}); LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, } $(document).ready(function(){ }); ] { "context" : "envParam:quiltName,message", "action" : "rerender" "action" : "pulsate" ] "useTruncatedSubject" : "true", ] } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "deleteMessage", } "event" : "MessagesWidgetEditAnswerForm", } "action" : "rerender" } { "event" : "MessagesWidgetAnswerForm", } "useTruncatedSubject" : "true", { window.location.replace('/t5/user/userloginpage'); { ] "action" : "addClassName" }, // Oops, not the right sequence, lets restart from the top. { ] "context" : "", "action" : "rerender" "includeRepliesModerationState" : "false", "actions" : [ })(LITHIUM.jQuery); "action" : "rerender" "actions" : [ { } watching = true; ] { "event" : "addMessageUserEmailSubscription", { }, "action" : "rerender" "action" : "rerender" "context" : "", // We made it! "context" : "", ] }); }, "context" : "envParam:quiltName", //$('#vodafone-community-header').css('display','block'); "triggerEvent" : "LITHIUM:triggerDialogEvent", ] } }, "actions" : [ "event" : "MessagesWidgetMessageEdit", "initiatorBinding" : true, "actions" : [ "context" : "envParam:feedbackData", "event" : "approveMessage", "actions" : [ "action" : "rerender" "context" : "envParam:quiltName", "event" : "unapproveMessage", } // Oops. LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/Archiv_Mobilfunk/thread-id/225454","ajaxErrorEventName":"LITHIUM:ajaxError","token":"soEIzMknx3kYQXngXE5_wbfn6DMU0WRBRO2rZeVat0E. "useSubjectIcons" : "true", }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_9","feedbackSelector":".InfoMessage"}); "action" : "pulsate" ] "action" : "rerender" "context" : "envParam:quiltName", { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_Mobilfunk/thread-id/234563","ajaxErrorEventName":"LITHIUM:ajaxError","token":"wIAXVAbi8uU0tKT1hp0xyF1iPI60cBuvwykfr5n36o4. "context" : "", { "actions" : [ "action" : "rerender" "action" : "rerender" "initiatorDataMatcher" : "data-lia-message-uid" { } "includeRepliesModerationState" : "false", "disallowZeroCount" : "false", } LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1804066 .lia-rating-control-passive', '#form'); } { "linkDisabled" : "false" "event" : "MessagesWidgetEditCommentForm", "action" : "pulsate" $('#user-menu .lia-header-nav-component-unread-count').each(function(e) { } "}); "actions" : [ '; { "displayStyle" : "horizontal", "kudosable" : "true", }, "actions" : [ "event" : "deleteMessage", "displayStyle" : "horizontal",